Protein Info for PGA1_c19880 in Phaeobacter inhibens DSM 17395

Annotation: methyltransferase, HemK family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00536: methyltransferase, HemK family
  • amino acids 7 to 278 (272 residues), 195.2 bits, E=1.2e-61
• PF17827: PrmC_N
  • amino acids 9 to 79 (71 residues), 54.5 bits, E=4.4e-18
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 29 to 275 (247 residues), 252 bits, E=6.3e-79
• PF02384: N6_Mtase
  • amino acids 89 to 190 (102 residues), 25.7 bits, E=2.1e-09
• PF05175: MTS
  • amino acids 101 to 191 (91 residues), 51.8 bits, E=2.3e-17
• PF06325: PrmA
  • amino acids 110 to 186 (77 residues), 26.6 bits, E=1.3e-09
• PF13847: Methyltransf_31
  • amino acids 115 to 186 (72 residues), 28.2 bits, E=4.6e-10
• PF13649: Methyltransf_25
  • amino acids 116 to 186 (71 residues), 30.4 bits, E=1.6e-10

Best Hits

Swiss-Prot: 58% identical to PRMC_RHOS4: Release factor glutamine methyltransferase (prmC) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 80% identity to sit:TM1040_0942)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See I7EN37 at UniProt or InterPro

Protein Sequence (285 amino acids)

>PGA1_c19880 methyltransferase, HemK family (Phaeobacter inhibens DSM 17395)
MNAPQTAAQAMAAAAARLRAAGVPDPARDARVLLAHAARIEASRVTLIAPEDLAPEIAER
YEQLIALRAIRVPVSHLIGEREFYGRRFKVSGDVLDPRPETECLIEAALAEPFSRVLDLG
LGSGCILVTLLAEQADATGVGVDLSEAACLQASANAVLHRVEPRAEVLQSDWFSAVDGQF
DLIVSNPPYIALDEMSGLSDEVRGHEPEMALTDGGDGLGAYRVIAAELGGYLAPQGRVFL
EIGPTQGAAVSDLLLSAGLKEVRVIQDLDGRDRVVCGRGCGENTS