Protein Info for Psest_1997 in Pseudomonas stutzeri RCH2

Annotation: 6-phosphogluconolactonase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF01182: Glucosamine_iso" amino acids 19 to 231 (213 residues), 175.3 bits, see alignment E=8.9e-56 TIGR01198: 6-phosphogluconolactonase" amino acids 21 to 229 (209 residues), 199.8 bits, see alignment E=2.4e-63

Best Hits

Swiss-Prot: 56% identical to 6PGL_PSEAE: 6-phosphogluconolactonase (pgl) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01057, 6-phosphogluconolactonase [EC: 3.1.1.31] (inferred from 83% identity to psa:PST_2328)

Predicted SEED Role

"6-phosphogluconolactonase (EC 3.1.1.31), eukaryotic type" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 3.1.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.31

Use Curated BLAST to search for 3.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKN5 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Psest_1997 6-phosphogluconolactonase (Pseudomonas stutzeri RCH2)
MAISELDLPIGVIAHSSADPQRQAELMADCVAGALAYAVQTHGVASLVVSGGRSPITFFE
ALSKRELNWAKVQISLADERWIPTGEPASNEGLVRRHLLQNAAREARLIGLYQPADSLAQ
AASLAELALEQLQQPIDVLVLGMGDDGHTASLFPGNPNLAHALRPDCPERCLPMQAPAEP
AARLTMTYPLLSCARMQCLAIQGADKLETLRAALHADPLQMPIRAFLYSPLEIYWCP