Protein Info for PGA1_c19810 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 50 to 77 (28 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 4 to 357 (354 residues), 255.7 bits, see alignment E=2.6e-80 PF03739: LptF_LptG" amino acids 6 to 357 (352 residues), 198.4 bits, see alignment E=9.5e-63

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 64% identity to sit:TM1040_0949)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DRH3 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PGA1_c19810 Predicted permeases (Phaeobacter inhibens DSM 17395)
MSRYDRYVLSQYLLFFGFFALILVAVFWINRAVVLFDRLIGDGQSALVFLEFTALALPNL
VRMVLPVAAFAASVWVTNRLNSESELTVLRATGTSPWQMAKPAMVFGLITAVMMSILTHV
LLPASIATLEQRESEVARNVTAKLLSEGDFLHPARGVTFYIGRIDPDGTLNDVFLSDRRN
AAESVTYTGGKAYLVRDGERTHLVMVDGMSQRINTETQRLSSTIFSDFSYDISSLANKAE
EKTRNIRAIPSLELLGDRAKLVADGPYSAGALAEELHLRFARALVCVAVVLIGFAALMLG
GFSRFGVWRQALLAFVLLIFVEGLRGVVSEPVLQNAELWPLIYIPTLIGLLVGLVFLQLA
AKPLGPILARGRHSRQNRRERAT