Protein Info for HP15_1902 in Marinobacter adhaerens HP15

Annotation: glucose-1-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K00978, glucose-1-phosphate cytidylyltransferase [EC: 2.7.7.33] (inferred from 55% identity to gvi:gll2185)

Predicted SEED Role

"Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33)" in subsystem dTDP-rhamnose synthesis (EC 2.7.7.33)

MetaCyc Pathways

CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (2/3 steps found)
CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (2/8 steps found)
streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPY6 at UniProt or InterPro

Protein Sequence (250 amino acids)

>HP15_1902 glucose-1-phosphate cytidylyltransferase (Marinobacter adhaerens HP15)
MRLREFSENIPKPMVPIGHRPIVWNLMKFYSHYGHKDFVICLGHNAHVIKQYFLKYDECL
TNDFVLEAGKPHLTKTDIHDWKITFADTGLKSNIGMRLKAVEKYLDDLGPDDMFMANYAD
GLSDVPLDDMLEFFKKSGKTACFLCVQPQQSFHYVRLNDDGTVHSIQDTTNTGLTVNGGF
FIFKKRIYEYIQDGEELVHEPFERLIAENELVAYRYDGFWKCMDTFKDKQAFDELNASGE
CPWQVWREKV