Protein Info for Psest_1985 in Pseudomonas stutzeri RCH2
Annotation: histidinol-phosphate aminotransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 82% identical to HIS82_PSEAE: Histidinol-phosphate aminotransferase 2 (hisC2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 93% identity to psa:PST_2340)Predicted SEED Role
"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- L-histidine biosynthesis (10/10 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- superpathway of chorismate metabolism (44/59 steps found)
- L-tyrosine degradation I (5/5 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-tyrosine biosynthesis III (3/4 steps found)
- L-phenylalanine degradation II (anaerobic) (2/3 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- L-phenylalanine biosynthesis II (2/4 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine biosynthesis II (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- superpathway of L-phenylalanine and L-tyrosine biosynthesis (2/5 steps found)
- superpathway of plastoquinol biosynthesis (2/5 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
- rosmarinic acid biosynthesis I (1/10 steps found)
- (S)-reticuline biosynthesis I (1/11 steps found)
- tropane alkaloids biosynthesis (1/11 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
- superpathway of rosmarinic acid biosynthesis (1/14 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Histidine metabolism
- Lysine biosynthesis
- Methionine metabolism
- Novobiocin biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.57, 2.6.1.9
Use Curated BLAST to search for 2.6.1.57 or 2.6.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GMH8 at UniProt or InterPro
Protein Sequence (369 amino acids)
>Psest_1985 histidinol-phosphate aminotransferase (Pseudomonas stutzeri RCH2) MSCDYLALAQPGVQKLSPYVPGKPVDELARELNLDPAGIVKLASNENPLGPSPKVLDAIR AELSELTRYPDGNGFALKQRLAERYSVGINQVTLGNGSNDILELIARAYLAPGLNAVFSE HAFAVYPIATQAVGAEGRAVPAKNWGHDLDAMAAAIDENTRVVFVANPNNPTGTWFDAAA LGGFLARVPEHVLVVLDEAYIEYAEGQELPDGLAFLADYPNLLVSRTFSKAYGLAALRVG YAISSPVIADVLNRVRQPFNVNSLALAAACAALDDVDYLLASRKANDAGMLQLETGFRQL GLEWIPSRGNFIAVDFARDATPINQALLREGVIVRPVAGYGMPTFLRVSIGTEQENARFL DVLRQVLAQ