Protein Info for Psest_1984 in Pseudomonas stutzeri RCH2

Annotation: chorismate mutase domain of proteobacterial P-protein, clade 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01807: chorismate mutase
  • amino acids 7 to 85 (79 residues), 115.1 bits, E=7.1e-38
• PF01817: CM_2
  • amino acids 10 to 93 (84 residues), 77.5 bits, E=1.1e-25
• PF00800: PDT
  • amino acids 97 to 273 (177 residues), 218.8 bits, E=7.6e-69
• PF01842: ACT
  • amino acids 283 to 348 (66 residues), 48 bits, E=1.2e-16

Best Hits

Swiss-Prot: 95% identical to CMPDT_PSEST: Bifunctional chorismate mutase/prephenate dehydratase (pheA) from Pseudomonas stutzeri

KEGG orthology group: K14170, chorismate mutase / prephenate dehydratase [EC: 4.2.1.51 5.4.99.5] (inferred from 99% identity to psa:PST_2341)

Predicted SEED Role

"Chorismate mutase I (EC 5.4.99.5) / Prephenate dehydratase (EC 4.2.1.51)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 4.2.1.51, EC 5.4.99.5)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
• L-tyrosine biosynthesis III (3/4 steps found)
• L-phenylalanine biosynthesis II (2/4 steps found)
• L-tyrosine biosynthesis II (2/4 steps found)
• superpathway of L-phenylalanine and L-tyrosine biosynthesis (2/5 steps found)
• bacilysin biosynthesis (1/10 steps found)
• salinosporamide A biosynthesis (3/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.51 or 5.4.99.5

Sequence Analysis Tools

See L0GIH3 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Psest_1984 chorismate mutase domain of proteobacterial P-protein, clade 2 (Pseudomonas stutzeri RCH2)
MSDADQLKALRVRIDSLDERILDLISERARCAQEVARVKTAALAEGESAVFYRPEREAWV
LKHIMELNRGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHAVI
STPMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHL
LVGETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIA
GDMAAQLYGLTKLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELL
VPFHANGIDLTRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLEKIGQEAVALKVLGSY
PKAVL