Protein Info for PGA1_c19730 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized homolog of Blt101

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 56 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 28 to 50 (23 residues), see Phobius details PF01679: Pmp3" amino acids 2 to 49 (48 residues), 81.5 bits, see alignment E=1.7e-27

Best Hits

Swiss-Prot: 80% identical to Y567_PSEAE: UPF0057 membrane protein PA0567 (PA0567) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 84% identity to rxy:Rxyl_0694)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EN20 at UniProt or InterPro

Protein Sequence (56 amino acids)

>PGA1_c19730 Uncharacterized homolog of Blt101 (Phaeobacter inhibens DSM 17395)
MDLIRIIAAVILPPLGVFLQVGLGKHFWLNILLTLLGYIPGIVHAVWVIAREPQHA