Protein Info for Psest_1972 in Pseudomonas stutzeri RCH2

Annotation: phenylalanyl-tRNA synthetase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF02912: Phe_tRNA-synt_N" amino acids 20 to 87 (68 residues), 89.1 bits, see alignment E=1.4e-29 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 38 to 337 (300 residues), 361.4 bits, see alignment E=2.2e-112 PF01409: tRNA-synt_2d" amino acids 92 to 337 (246 residues), 361 bits, see alignment E=3.3e-112

Best Hits

Swiss-Prot: 93% identical to SYFA_PSEMY: Phenylalanine--tRNA ligase alpha subunit (pheS) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 97% identity to psa:PST_2365)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIG4 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Psest_1972 phenylalanyl-tRNA synthetase, alpha subunit (Pseudomonas stutzeri RCH2)
MENLDALVSQALEAVQRSEDIAALEQVRVQYLGKKGELTQLMQALGRLSAEERPQAGALI
NAAKNSVQDVLNARKADLELAALNAKLAAEQIDVTLPGRGELSGGLHPVTRTLERVEQFF
SHIGYSVAEGPEVEDDYHNFEALNIPGHHPARAMHDTFYFNANMLLRTHTSPVQVRTMES
RQPPIRIVCPGRVYRCDSDITHSPMFHQVEGLLIDEGISFADLKGTIEEFLRVFFEKPLG
VRFRPSFFPFTEPSAEVDMQCVMCSGKGCRVCKQTGWLEVMGCGMVHPNVLRMSGIDPER
YSGFAFGMGVERLAMLRYGVNDLRLFFDNDLRFLAQFR