Protein Info for PGA1_c19610 in Phaeobacter inhibens DSM 17395

Annotation: Small integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 57 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 29 to 51 (23 residues), see Phobius details PF07043: DUF1328" amino acids 6 to 44 (39 residues), 62.7 bits, see alignment E=1.6e-21

Best Hits

Swiss-Prot: 70% identical to Y3712_SHEDO: UPF0391 membrane protein Sden_3712 (Sden_3712) from Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)

KEGG orthology group: None (inferred from 74% identity to rcp:RCAP_rcc02293)

Predicted SEED Role

"putative transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DRF5 at UniProt or InterPro

Protein Sequence (57 amino acids)

>PGA1_c19610 Small integral membrane protein (Phaeobacter inhibens DSM 17395)
MLGWALTFLVVALIAGLLGFGGIAGASAGIAKILFIIFLVLFVVAMVMRALKGKPPV