Protein Info for HP15_1883 in Marinobacter adhaerens HP15

Annotation: recombination protein RecR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR00615: recombination protein RecR" amino acids 2 to 196 (195 residues), 248.1 bits, see alignment E=2.4e-78 PF21176: RecR_HhH" amino acids 7 to 51 (45 residues), 79.3 bits, see alignment 3.7e-26 PF02132: RecR_ZnF" amino acids 54 to 74 (21 residues), 25.5 bits, see alignment (E = 2.3e-09) PF01751: Toprim" amino acids 81 to 160 (80 residues), 50.6 bits, see alignment E=4.4e-17 PF13662: Toprim_4" amino acids 81 to 171 (91 residues), 87.1 bits, see alignment E=1.9e-28 PF21175: RecR_C" amino acids 173 to 196 (24 residues), 41.9 bits, see alignment (E = 1.3e-14)

Best Hits

Swiss-Prot: 91% identical to RECR_MARHV: Recombination protein RecR (recR) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K06187, recombination protein RecR (inferred from 91% identity to maq:Maqu_1611)

MetaCyc: 59% identical to recombination mediator protein RecR (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"Recombination protein RecR" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPG0 at UniProt or InterPro

Protein Sequence (200 amino acids)

>HP15_1883 recombination protein RecR (Marinobacter adhaerens HP15)
MAFSPLVDELVESLRCLPGVGQKTAQRMAFHLLERGRSGGTRLSEALSQAMSGVRRCESC
QNFADTEICGICENPQRRTGTLCVVESPSDLLAIEQAGDYRGGYFVLMGHLSPIDGVGPE
EIGIERLLKRIRDEGVTELILATNPTVEGEATAHYIADRLDGQGILITRLAHGIPVGGEL
GYVDGFTLTHAFRGRKPLSD