Protein Info for Psest_1965 in Pseudomonas stutzeri RCH2

Annotation: ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13529: Peptidase_C39_2" amino acids 38 to 172 (135 residues), 46.1 bits, see alignment E=7.2e-16 PF03412: Peptidase_C39" amino acids 44 to 168 (125 residues), 27.9 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 74% identity to psa:PST_2372)

Predicted SEED Role

"FIG00956004: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIF9 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Psest_1965 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain (Pseudomonas stutzeri RCH2)
MSQRLLILLLVGLLGGCARTTVTLVDDAQLPARAELTEVPFYPQDDYQCGPAALATMLSQ
RGIATTPDALVDQVYIPQRKGSLQVEMVAAARSSGLLVYPLQPRLEDLLAEVAAGNPVLV
LQNLAFDRWPQWHFAVVVGYDLSTQQVVLRSGTTKRWVGSFREFERSWVKAERWAVVTLS
ADQMPHTAQETVWLRSASDLEEVGQVRAARAAYEAAVTRWDSALSRFALANSQYTMGEKS
AAEESLRVSVRLDPGFAIGWFNLSQLLAEQGCGSSAQEARNCAIRLAPNDKRFRVALPAQ
EERRAAQCVPIPPCSAP