Protein Info for PGA1_c01960 in Phaeobacter inhibens DSM 17395

Annotation: putative hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF00702: Hydrolase" amino acids 6 to 184 (179 residues), 82.1 bits, see alignment E=1.4e-26 PF13419: HAD_2" amino acids 8 to 190 (183 residues), 108.7 bits, see alignment E=7.7e-35 PF12710: HAD" amino acids 8 to 181 (174 residues), 31.1 bits, see alignment E=6.3e-11 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 88 to 184 (97 residues), 34.8 bits, see alignment E=3.1e-12 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 129 to 190 (62 residues), 31.1 bits, see alignment E=3.7e-11 PF13242: Hydrolase_like" amino acids 146 to 212 (67 residues), 56.6 bits, see alignment E=3.9e-19

Best Hits

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 66% identity to sit:TM1040_0292)

Predicted SEED Role

"Similar to phosphoglycolate phosphatase, clustered with ribosomal large subunit pseudouridine synthase C" in subsystem 2-phosphoglycolate salvage

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWX4 at UniProt or InterPro

Protein Sequence (222 amino acids)

>PGA1_c01960 putative hydrolase (Phaeobacter inhibens DSM 17395)
MSGDLRLILFDVDGTLADSQGAITSAMRATFDGVGLAAPSRAEILSIVGLSLPLAIAELA
PTLDASVQAELVEGYKSAYKSARLAAGAGHSPLYPGAAEVLAELNAVPEYLLGVATGKSQ
RGLDALIEAHELRCFVTRQCADHHPSKPHPSMILRAMADTGVAAAHTVMIGDTSFDIDMG
RAAGVRTIAVNWGFHPADQLGADHIIDSFADLAPLLQHIWKD