Protein Info for Psest_1953 in Pseudomonas stutzeri RCH2

Annotation: deoxyguanosinetriphosphate triphosphohydrolase, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 TIGR01353: putative dGTPase" amino acids 24 to 432 (409 residues), 317.9 bits, see alignment E=7.2e-99 PF01966: HD" amino acids 61 to 126 (66 residues), 26 bits, see alignment E=5e-10

Best Hits

Swiss-Prot: 88% identical to DGTL2_PSEA8: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (PLES_20171) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 96% identity to psa:PST_2384)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.5.1

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GL50 at UniProt or InterPro

Protein Sequence (443 amino acids)

>Psest_1953 deoxyguanosinetriphosphate triphosphohydrolase, putative (Pseudomonas stutzeri RCH2)
MDWHTLLTRERLGKSAHSGDELGRSPFHKDHDRIIFSGAFRRLGRKTQVHPVSSNDHIHT
RLTHSLEVSCVGRSLGMRVGEVLRDDLPEWCSPADLGMIVQSACLAHDIGNPPFGHSGED
AIRCWFQQAAGRGWLDDMSDAQRADFLNFEGNAQGFRVLTQLEYHQFDGGTRLTYATLGT
YLKYPWTSRHAEALGYKKHKFGCYQNERPLLEQIAQKLDLPQVAEQRWARHPLVYLMEAA
DDICYGLIDLEDGLEMELLEYSEVEALLLALVGDDIPETYRQLGPRDSRRRKLAILRGKA
IEHLTNAAAGAFVEQQSALLRGELHGDLVEHMHGPAKECVLQAKAMARQKIFQDKRKTLH
EIGAYTTLEILLNAFCGAALEQHRGGTPSFKNQRILDLLGRSAPSPELPLYQSFLRMIDF
IAGMTDSYATEMAGEMTGRSSPV