Protein Info for Psest_1952 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 89 to 105 (17 residues), see Phobius details amino acids 114 to 132 (19 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 219 to 221 (3 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 265 to 282 (18 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details PF13515: FUSC_2" amino acids 208 to 329 (122 residues), 65.9 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_2385)

Predicted SEED Role

"FIG00960787: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKK2 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Psest_1952 hypothetical protein (Pseudomonas stutzeri RCH2)
MKRLLRQSIHWHPGRPAWGAAMVAGFGCALPLLLGLFSGHPGFLWATVGAFQAAKANPLH
RFGMLRMLLLIALGAGSAGLGFWSATHPLISLGLFAFYGLLLAWLQRYGSEAGKLGIGLA
ICLCLGQGQYGIGEFNNPYAIAVLFALGGLWVTLLAFGMRGMHGLRMWPYMPRLMSILRV
LRRHARRTPIRQWRVHALTYTLAGAIGGVIVNMASLPRGYWLTLAVFTTLQMDLERSLVR
ALQASLGILAAAAILIYIGHGLADPPLMVMILLPLVVLGRAFQANHYGLFVLQTTLLFLL
LAETLAQDWNLPQIRLINAAIGVGVALLIATLMHLLQMLLARRSRRKAQLAAQRSDEQTT
SQP