Protein Info for Psest_0192 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00072: Response_reg" amino acids 11 to 117 (107 residues), 100.8 bits, see alignment E=1.5e-32 PF00158: Sigma54_activat" amino acids 149 to 313 (165 residues), 222.7 bits, see alignment E=7.3e-70 PF14532: Sigma54_activ_2" amino acids 151 to 317 (167 residues), 56.9 bits, see alignment E=8.5e-19 PF07728: AAA_5" amino acids 170 to 290 (121 residues), 28.7 bits, see alignment E=3.7e-10 PF00004: AAA" amino acids 171 to 289 (119 residues), 22.7 bits, see alignment E=3.6e-08 PF02954: HTH_8" amino acids 406 to 446 (41 residues), 32.1 bits, see alignment 2.2e-11

Best Hits

Swiss-Prot: 82% identical to ALGB_PSEPK: Alginate biosynthesis transcriptional regulatory protein AlgB (algB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K11384, two-component system, NtrC family, response regulator AlgB (inferred from 98% identity to psa:PST_4053)

Predicted SEED Role

"alginate biosynthesis transcriptional regulatory protein AlgB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GDH8 at UniProt or InterPro

Protein Sequence (448 amino acids)

>Psest_0192 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains (Pseudomonas stutzeri RCH2)
MDQTTDNGGRILLVDDEAAILRTFRYCLEDRGYTVMTAASAAQAEAILQRQVFDLCFLDL
RLGEDNGLDVLQQMRMLAPWMRVVIVTVHSAVDTAVDAMQAGAADYLLKPCSPEQLRLSA
AKQLEVRQMAARLEALEGEIKQRSDALGSHSPAMMAVLETARQVADTDANILILGESGTG
KGELARAIHTWSRRSKKAFVTINCPSLSADLMESELFGHNRGAFTGATESTLGRVNQADG
GTLFLDEIGDFPLALQPKLLRFIQDKEYERVGDPVTRRADVRILAATNLNLEEMVREGKF
REDLLYRLNVITLNLPPMRERPEDVLALAERFLASFVKNYGRPARGFSDAAIAALKTYRW
PGNVRELRNVVERASIICPQQMIEVSHLGLGEQVGSNAPRIGEPLSLEALEKAHIAGVLS
TSDTLEQAARILGIDASTLYRKRKQYGL