Protein Info for HP15_1865 in Marinobacter adhaerens HP15

Annotation: MaoC domain protein dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13452: FAS1_DH_region
  • amino acids 22 to 134 (113 residues), 26.6 bits, E=8.7e-10
• PF01575: MaoC_dehydratas
  • amino acids 25 to 123 (99 residues), 85.4 bits, E=3.6e-28
• PF03061: 4HBT
  • amino acids 74 to 133 (60 residues), 25.2 bits, E=2.4e-09

Best Hits

KEGG orthology group: None (inferred from 89% identity to maq:Maqu_1594)

MetaCyc: 54% identical to (R)-specific enoyl-CoA hydratase (Pseudomonas oleovorans)
RXN-7699 [EC: 4.2.1.119]

Predicted SEED Role

"enoyl-CoA hydratase, R-specific" in subsystem n-Phenylalkanoic acid degradation

MetaCyc Pathways

• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• polyhydroxydecanoate biosynthesis (1/3 steps found)
• fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
• 6-gingerol analog biosynthesis (engineered) (2/6 steps found)
• 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (4/10 steps found)
• 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
• stearate biosynthesis I (animals) (1/6 steps found)
• 10-cis-heptadecenoyl-CoA degradation (yeast) (2/12 steps found)
• 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (2/12 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• superpathway of testosterone and androsterone degradation (6/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.119

Sequence Analysis Tools

See E4PPE2 at UniProt or InterPro

Protein Sequence (161 amino acids)

>HP15_1865 MaoC domain protein dehydratase (Marinobacter adhaerens HP15)
MSDTLDTLENITYDELNEGDTATFTRTLTEDELVLFAAVSGDVNPVHLDSEFAAGSMFKE
RIAHGMWSGSLISAALATVMPGPGTIYLEQSLSFKRPVKLDDTLTVHLKVLRKEPKGRVV
VECDVRNQNEQKVVIGEAKVIAPTEKVSLHKPRLPKIAIEH