Protein Info for HP15_1861 in Marinobacter adhaerens HP15

Annotation: thioesterase superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF13279: 4HBT_2" amino acids 1 to 112 (112 residues), 70.6 bits, see alignment E=1.7e-23 PF03061: 4HBT" amino acids 4 to 82 (79 residues), 40.6 bits, see alignment E=2.7e-14

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 86% identity to maq:Maqu_1590)

Predicted SEED Role

"FIG00784260: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPD8 at UniProt or InterPro

Protein Sequence (116 amino acids)

>HP15_1861 thioesterase superfamily protein (Marinobacter adhaerens HP15)
MDAYGHANNTVYFRFFEEARIVWLASLELGGPDEPTGPVIIKTSATFLKELNHPATVEVK
TYADKAGNTSLDTYHLLTDVDTGAVYAEGYAKIVWFDRKTRSSAPLPDTLRALATS