Protein Info for PGA1_c19320 in Phaeobacter inhibens DSM 17395

Annotation: putative transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF01695: IstB_IS21" amino acids 14 to 249 (236 residues), 260.3 bits, see alignment E=2.6e-81 PF00308: Bac_DnaA" amino acids 103 to 203 (101 residues), 33.3 bits, see alignment E=8.6e-12 PF00004: AAA" amino acids 105 to 204 (100 residues), 21.6 bits, see alignment E=3.8e-08

Best Hits

Swiss-Prot: 36% identical to ISTB_GEOSE: Insertion sequence IS5376 putative ATP-binding protein from Geobacillus stearothermophilus

KEGG orthology group: None (inferred from 81% identity to avi:Avi_3045)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>PGA1_c19320 putative transposase (Phaeobacter inhibens DSM 17395)
MRHDPAGASIVIMLRSLKLYGMANAVEDLGAQGAPAFEAAIPMLSQLLKAEIAEREVRSI
AYHTKIARFPAYKDLSGFDFTSSEINEAKVRQLHRCEFIEAAENVVLIGGPGTGKSHTAT
AIGVQAIEHHRRKVRFFSTVELVNALEQEKALGKAGKLAETLTKVDLVILDELGYLPFSS
SGGALLFHLLSKLYERTSVIITTNLSFSEWAQVFGDAKMTTALLDRLTHRCHILETGNDS
YRFKASAEAAKKTRKEAKTLTAS