Protein Info for PGA1_c01940 in Phaeobacter inhibens DSM 17395

Annotation: crcB-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 17 to 18 (2 residues), see Phobius details amino acids 35 to 58 (24 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details PF02537: CRCB" amino acids 6 to 118 (113 residues), 87.5 bits, see alignment E=3.6e-29 TIGR00494: protein CrcB" amino acids 6 to 119 (114 residues), 84.5 bits, see alignment E=3.6e-28

Best Hits

Swiss-Prot: 72% identical to CRCB_RUEST: Putative fluoride ion transporter CrcB (crcB) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K06199, CrcB protein (inferred from 72% identity to sit:TM1040_0290)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETE5 at UniProt or InterPro

Protein Sequence (126 amino acids)

>PGA1_c01940 crcB-like protein (Phaeobacter inhibens DSM 17395)
MVFSVLYVALGGAIGAACRYLAGLGITRLFGVGEFPVAILAVNVIGSFLMGAFVVTAAHK
GLTHLSPFVMTGLLGGFTTFSAFSLETATLIERGAFGQAALYVLLSVGLSVGGLFFGLMA
ARGVFA