Protein Info for Psest_1940 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein containing a von Willebrand factor type A (vWA) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 303 to 326 (24 residues), see Phobius details PF00092: VWA" amino acids 91 to 280 (190 residues), 71.4 bits, see alignment E=1.7e-23 PF13519: VWA_2" amino acids 92 to 203 (112 residues), 61.2 bits, see alignment E=2e-20

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 95% identity to psa:PST_2397)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GME4 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Psest_1940 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain (Pseudomonas stutzeri RCH2)
MFELAWPWIFVLLPLPWLLRALLPPADSGEAALKVSFLDELQQLAGRRARVALPAWRQQL
PYLTIWLLLLFAAARPQWLGEPLPLPTSGRDLLLAVDVSGSMDYPDMQWQGEELTRLELV
KVLLGDFIEQRHGDRVGLILFGSKAYLQAPLTFDRRTVRVWLDEARVGIAGSNTAIGDAI
GLAVKRLRDRPASSRVLVLITDGASNGGEIEPLLAASLAAEEGVRIHTIGIGAVPEEGGV
LSRFGFNPGLDLDEPTLRAIAEQTGGEYFRAASSAELKAIGATLDRLEPAAQQPIQARVA
EALYFWPLAAALLISLLMVAASLWSAQLQRLAWRREQRR