Protein Info for HP15_1853 in Marinobacter adhaerens HP15

Annotation: phosphoadenosine phosphosulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 18 to 232 (215 residues), 166.6 bits, E=7.2e-53
• PF01507: PAPS_reduct
  • amino acids 29 to 207 (179 residues), 182.8 bits, E=3.1e-58
• TIGR02055: adenylylsulfate reductase, thioredoxin dependent
  • amino acids 36 to 231 (196 residues), 268.3 bits, E=3.8e-84

Best Hits

Swiss-Prot: 68% identical to CYSH_PSEAE: Phosphoadenosine phosphosulfate reductase (cysH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 86% identity to maq:Maqu_1582)

MetaCyc: 43% identical to assimilatory adenylyl-sulfate reductase (Allochromatium vinosum)
Adenylyl-sulfate reductase (glutathione). [EC: 1.8.4.9]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction II (2/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• selenate reduction (2/5 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8 or 1.8.4.9

Sequence Analysis Tools

See E4PPD0 at UniProt or InterPro

Protein Sequence (240 amino acids)

>HP15_1853 phosphoadenosine phosphosulfate reductase (Marinobacter adhaerens HP15)
MTDIQTLREELEGQSPRSILKAALQQYDNIAISFSGAEDVVLIEMAHKLTDNLKVFTLDT
GRLHPETYDFVERVRKHYGIEIEVLFPDAHEVQDLVNKKGLFSFYEDGHGECCGIRKVNP
LRRKLATVDAWITGQRKDQSPGTRNDVPVIQEDTAFSTNEKTLVKFNPLANWTSKEVWDY
IRMSEAPYNKLHEKGFVSIGCQPCTRPVLPGQHEREGRWWWEEATQKECGLHAGNLIARE