Protein Info for HP15_1852 in Marinobacter adhaerens HP15

Annotation: homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02137: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein
  • amino acids 16 to 214 (199 residues), 339.4 bits, E=6e-106
• TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB
  • amino acids 17 to 174 (158 residues), 45.7 bits, E=7.2e-16
• PF00702: Hydrolase
  • amino acids 73 to 177 (105 residues), 41.2 bits, E=2.4e-14
• PF12710: HAD
  • amino acids 83 to 174 (92 residues), 39.7 bits, E=7.4e-14

Best Hits

Swiss-Prot: 76% identical to THRH_PSEAE: Phosphoserine phosphatase ThrH (thrH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02203, phosphoserine / homoserine phosphotransferase [EC: 2.7.1.39 3.1.3.3] (inferred from 96% identity to maq:Maqu_1581)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 2.7.1.39 or 3.1.3.3

Sequence Analysis Tools

See E4PPC9 at UniProt or InterPro

Protein Sequence (218 amino acids)

>HP15_1852 homoserine kinase (Marinobacter adhaerens HP15)
MTVLALYQSKQEIVVELACLDLEGVLIPEIWIAFAEKTGIEELKATTRDIPDYDVLMKQR
LKLLDQHGYGLPQIQEVIGELDPLPGAREFLDWLRERFQVVILSDTFYEFAMPLMKKLGY
PALLCHKLEVADDGQITNYLLRQRDPKRQSVRAFQLLNYRVIAAGDSYNDTTMLGQAEAG
ILFHAPQNVIDEFPQFPAVHNFDDLRQEFLKASEIHSA