Protein Info for Psest_1923 in Pseudomonas stutzeri RCH2

Updated annotation (from data): adhesin-associated BNR repeat protein
Rationale: Conserved cofit with a putative adhesin (Psest_1122). This is also predicted to be an outer membrane protein.
Original annotation: Uncharacterized protein related to plant photosystem II stability/assembly factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details PF14870: PSII_BNR" amino acids 99 to 147 (49 residues), 36.6 bits, see alignment 6.4e-13 amino acids 152 to 274 (123 residues), 53.9 bits, see alignment E=3.6e-18

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_2414)

Predicted SEED Role

"FIG002465: BNR repeat protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIA9 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Psest_1923 adhesin-associated BNR repeat protein (Pseudomonas stutzeri RCH2)
MSEPVLRRTLSGRAKVANQARASRFHSSVAGMLSLCGTFSLLLLAASAPAQAATDGQTRY
SIESAKAASNLLLDITQAGDRIVAAGDRGHILYSDDEGTSWTQAKVPTRQLLTAIDFIDA
KHGWAVGHDALVLATADGGESWAVQYEEREREAPLLDVWFEDTQHGIAVGAYGALIETID
GGQSWDDISERLDNEDGFHLNAITHIEGSGLFVVGEMGGMFRSADMGETWERVDSPYKGS
FFGVVGGSEPGVVIAFGLRGHLFRSTDFGDSWQAIELSNGNGQALESGLADGSLLRDGRI
AVVGHGGAVLTSDDQGRSFKLVNRPDRRSLSGVTSDSQGNLILVGQGGVRIASPSGADLA
PKQ