Protein Info for PGA1_c01920 in Phaeobacter inhibens DSM 17395

Annotation: protease DegQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00089: Trypsin" amino acids 90 to 250 (161 residues), 51.3 bits, see alignment E=3.6e-17 PF13365: Trypsin_2" amino acids 91 to 227 (137 residues), 116.3 bits, see alignment E=5e-37 PF13180: PDZ_2" amino acids 291 to 357 (67 residues), 32.7 bits, see alignment E=1.8e-11 PF17820: PDZ_6" amino acids 407 to 441 (35 residues), 30.7 bits, see alignment 5.5e-11

Best Hits

KEGG orthology group: K01362, [EC: 3.4.21.-] (inferred from 69% identity to sit:TM1040_0287)

Predicted SEED Role

"Periplasmic serine protease, DO/DeqQ family"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVV9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>PGA1_c01920 protease DegQ (Phaeobacter inhibens DSM 17395)
MFRAILTAAGLFLATQIPSTQALADTRVPQNQAEISLGFAPLVKEAAPAVVNIYAKIVHE
QRRTPFMNDPFFDDFFRGLSKPQPRVQNSLGSGVILSPDGIVVSNYHVVGMATDIRVVTT
DRREYAAQVVLADQASDLAILQLEEAEDLPYLELRDSDGVEVGELALAIGNPFGVGQTVS
SGIVSGLARSGAATGEGIGYFIQTDAPINPGNSGGALIDVNGDLIGINTRIVTRSGGSNG
IGFAIPANLVRAFMRQAHDGAEEFQRPWAGMMGQPVDADLAASLGMDLPEGMVISELHPA
SPFTKAGFEVGDVVLDVAGEVVNSPSEMVFRMSVTGLGDTAEVTRLRAGEREVLTVEMML
APDEPPANPLSLDEGTPLPGLTVARINPQSILRFQLPMSSDGVVITDPGAYGSRVGLRAG
DIILGINNEAIKTPADVSEVLGNIGRWMKVDLNRQGQRVSLRYRL