Protein Info for Psest_1919 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized membrane protein (homolog of Drosophila rhomboid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 80 to 103 (24 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 255 to 283 (29 residues), see Phobius details PF16733: NRho" amino acids 4 to 68 (65 residues), 88 bits, see alignment E=3.8e-29 PF01694: Rhomboid" amino acids 137 to 278 (142 residues), 106.7 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: K02441, GlpG protein (inferred from 95% identity to psa:PST_2418)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMB9 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Psest_1919 Uncharacterized membrane protein (homolog of Drosophila rhomboid) (Pseudomonas stutzeri RCH2)
MSVEVSEALRLPLSEDLSGFIALLRRLRVPCRVSEEGDQQVLRVPVEVVEQVRDLYARHP
HGDDSVVIEQPRRRGGFVAALRASPLTAAVLVITLVVAAITMLGENFATIRWLNFVDFRI
DGEYAYFASLEQTLAAGQWWRLITPIFVHFGILHLAMNSMWFWELGRRIEALQRAWMLLA
LTLLFGLVSNFAQYLFGGPGIFGGLSGVLYGLLGHCWLYQKLAPNEAYRLPPGVVVLMLV
WLVICLTGVIEVLSFGALAIANAAHVGGLVAGCVTGVIGGTLARRR