Protein Info for HP15_1836 in Marinobacter adhaerens HP15

Annotation: major facilitator superfamily MFS_1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details PF03825: Nuc_H_symport" amino acids 2 to 165 (164 residues), 27.8 bits, see alignment E=2e-10 PF07690: MFS_1" amino acids 2 to 176 (175 residues), 55.6 bits, see alignment E=6.7e-19 PF12832: MFS_1_like" amino acids 3 to 152 (150 residues), 152.1 bits, see alignment E=3.7e-48

Best Hits

Predicted SEED Role

"Nucleoside:H+ symporter:Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPB3 at UniProt or InterPro

Protein Sequence (179 amino acids)

>HP15_1836 major facilitator superfamily MFS_1 (Marinobacter adhaerens HP15)
MNFLLQVSHGAYYTFFSIHLEQHGYGKLSIGLLWSLGVFAEIALFLVMHRLTRSFTVRQI
AIGALTLTMIRWVLIAELTDVVLVLLFAQLLHAASYGALHAISVQYIQGFFGKYHHGQGQ
ALYSGLTFGAGGALGAWLSGFLVDGFSTSAAFWGGAAAMALAIVITWRGLRPPPAHGEG