Protein Info for Psest_1918 in Pseudomonas stutzeri RCH2

Annotation: Calcineurin-like phosphoesterase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF00149: Metallophos" amino acids 11 to 140 (130 residues), 49 bits, see alignment E=5.4e-17

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_2419)

Predicted SEED Role

"Diadenosine tetraphosphatase and related serine/threonine protein phosphatases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI98 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psest_1918 Calcineurin-like phosphoesterase. (Pseudomonas stutzeri RCH2)
MQLDPERGYDLIGDVHGCGRALARLLDQLGYRLQGGVWRHSRRQVIFLGDIIDRGPHIRE
ALHLVYDMVDRGQAYCIMGNHEFNALGWYMPAPPGSGRDFVREHSPRFARLLQETFEQFE
RYPDEWRAFREWFYELPLFLESERFRVVHACWDSWVIARLRPFLNDACLNPAILREAGLP
GTFICQALDRLLRGTDMPLPEGMTLTSEEGFVRTFFRTKFWEENPQTYGDVVFQPDGLPD
HAARMPLSAQQKNRLFLYGPDEPLLFVGHYWRRGQPGPLRDNLACLDYSAVKNGKLVAYR
LDQEVRLDPAKFVWVDVCAVFRT