Protein Info for Psest_1914 in Pseudomonas stutzeri RCH2

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 7 to 38 (32 residues), see Phobius details amino acids 44 to 64 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 164 (31 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details PF01925: TauE" amino acids 9 to 245 (237 residues), 172.4 bits, see alignment E=6.8e-55

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 93% identity to psa:PST_2423)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMA3 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Psest_1914 Predicted permeases (Pseudomonas stutzeri RCH2)
MLLDIGLNVLLGLALGTLGGLFGIGGGLIAIPVLGVLFGLDQQLAQGTALVMVVPNVLLA
IWRYHQRNRIDWRNAVALGSTSFLFAILGAAVAVSLDAGRMRMAFVGFLLALAAYTLLRV
FLRPTPGNGQLRHSWPWLSLLGAGAGAAGGLFGVGGAVIATPILTSVFGASQVVAQGLSL
ALAAPSTGVTLVTYALHGQVNWLLGIPLAAGGLLSISLGVRLAHALPERLLRLLFSLFLV
ASAVLLALES