Protein Info for HP15_1829 in Marinobacter adhaerens HP15

Annotation: tRNA pseudouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 18 to 255 (238 residues), 218.4 bits, see alignment E=5.2e-69 PF01416: PseudoU_synth_1" amino acids 22 to 119 (98 residues), 30.5 bits, see alignment E=2.3e-11 amino acids 159 to 261 (103 residues), 113 bits, see alignment E=4.9e-37

Best Hits

Swiss-Prot: 57% identical to TRUA_COXBR: tRNA pseudouridine synthase A (truA) from Coxiella burnetii (strain RSA 331 / Henzerling II)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 81% identity to maq:Maqu_1560)

MetaCyc: 54% identical to tRNA pseudouridine38-40 synthase (Escherichia coli K-12 substr. MG1655)
tRNA-pseudouridine synthase I. [EC: 5.4.99.12]

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPA6 at UniProt or InterPro

Protein Sequence (302 amino acids)

>HP15_1829 tRNA pseudouridine synthase A (Marinobacter adhaerens HP15)
MFLKTQQLSTDNAVGAGRVALAFEYDGRGFHGWQLQKSGVRSVEAELTAAVAKVANHAVD
LVCAGRTDAGVHASYQIAHFDTPSVRNLRSWVMGINTALPDDISVHWAGNGVGDFHARFS
ATYRRYRYIIYNHPVRPGIQRGQVSWTFRPLDADRMHRAAQALAGEHDFSSFRAAGCQSR
TPIRFLERISVTRKRDFVVIDVQANAFLHHMVRNIAGALMAVGSGKQRPEWIHEILVARD
RTAAGVTAPPHGLYLVDVGYPEEFGIPAVECGPGFLRPWFTREENSPFTPTHIHVKQRVP
SQ