Protein Info for HP15_1825 in Marinobacter adhaerens HP15

Annotation: acetyl-CoA carboxylase, carboxyl transferase, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit" amino acids 4 to 284 (281 residues), 420 bits, see alignment E=2.4e-130 PF17848: Zn_ribbon_ACC" amino acids 28 to 53 (26 residues), 39.7 bits, see alignment (E = 4.5e-14) PF01039: Carboxyl_trans" amino acids 96 to 242 (147 residues), 63.8 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 90% identical to ACCD_MARHV: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 90% identity to maq:Maqu_1556)

MetaCyc: 63% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPA2 at UniProt or InterPro

Protein Sequence (308 amino acids)

>HP15_1825 acetyl-CoA carboxylase, carboxyl transferase, beta subunit (Marinobacter adhaerens HP15)
MSNWLDKIMPSKIRSESKQRTGVPEGLWKKCPKCGAFLYKPELEKNLDVCPKCNHHLRVT
ARRRLEIFLDPEGREEVAAELEPWDRLKFKDSKRYKDRLSQAQKATGEKDALVAMKGTTL
GVPLVACAFEFGFLGGSMGQVVGEKFVQAANVALKERIPLVCFSASGGARMQEAILSLMQ
MSKTAAVLERMKVEGIPYISVMTDPVFGGVSASLAMLGDLNIAEPNALIGFAGPRVIEQT
VREKLPEGFQRSEFLLEHGAIDMILHRHQMRERIAHVLAKFTGQERPGTEDPIEFEVSEK
PETDAPAE