Protein Info for Psest_1894 in Pseudomonas stutzeri RCH2

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00072: Response_reg" amino acids 8 to 120 (113 residues), 108.5 bits, see alignment E=2.2e-35 PF00486: Trans_reg_C" amino acids 156 to 232 (77 residues), 70.6 bits, see alignment E=9.6e-24

Best Hits

Swiss-Prot: 36% identical to REGX3_MYCS2: Sensory transduction protein regX3 (regX3) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 98% identity to psa:PST_2442)

Predicted SEED Role

"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM33 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Psest_1894 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Pseudomonas stutzeri RCH2)
MSQAGKNILLVDDDQEIRELLQTYLSRSGFQVRGVPDGGEFRAALCAEPADLVILDVMLP
DEDGFSLCRWIRQHERLASMPIIMLTASSDEADRVIGLELGADDYLGKPFSPRELLARIK
ALLRRVSFAQERGSDVLAFDEWRLDMISHRLFHADGEEVFLSGADFALLKLFLDHPQQIL
DRDTIANATRGREVMPLERIVDMAVSRLRQRLRDTGKSPRLIRTVRGSGYLLATQVTPHH
ESAH