Protein Info for Psest_1893 in Pseudomonas stutzeri RCH2

Annotation: glucokinase, proteobacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR00749: glucokinase" amino acids 5 to 310 (306 residues), 259.7 bits, see alignment E=1.9e-81 PF02685: Glucokinase" amino acids 5 to 314 (310 residues), 367.1 bits, see alignment E=6.7e-114

Best Hits

Swiss-Prot: 57% identical to GLK_PSEA8: Glucokinase (glk) from Pseudomonas aeruginosa (strain LESB58)

KEGG orthology group: K00845, glucokinase [EC: 2.7.1.2] (inferred from 89% identity to psa:PST_2443)

Predicted SEED Role

"Glucokinase (EC 2.7.1.2)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis (EC 2.7.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.2

Use Curated BLAST to search for 2.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM83 at UniProt or InterPro

Protein Sequence (320 amino acids)

>Psest_1893 glucokinase, proteobacterial type (Pseudomonas stutzeri RCH2)
MSTALVGDIGGTNARFALWRDQRIEQIRVLPTADYASPELAIRAYLREVDQPLDALEAVC
LACAGPVGGDLFRFTNNHWQLSREAFCRELGVKELLLINDFTAMALGMTRLHDGERITVC
QGEPEPGRPRLVIGPGTGLGVAGLLPLSGGGWRALPGEGGHICLPIGSEREAAIWAHLHR
SQGHVNAEAVLSGPGLLTLYRACCALDGQQVEFDSPAAITKAALAGDAYATAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEMFLRSGFSEALREKGQMSRYFDRLPVWLVT
APYPGLEGAGVALQPLLEGA