Protein Info for Psest_1891 in Pseudomonas stutzeri RCH2

Annotation: segregation and condensation protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 TIGR00281: segregation and condensation protein B" amino acids 9 to 173 (165 residues), 120.7 bits, see alignment E=2.8e-39 PF04079: SMC_ScpB" amino acids 12 to 172 (161 residues), 179 bits, see alignment E=2.7e-57

Best Hits

KEGG orthology group: K06024, segregation and condensation protein B (inferred from 93% identity to psa:PST_2445)

Predicted SEED Role

"Segregation and condensation protein B" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKX1 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Psest_1891 segregation and condensation protein B (Pseudomonas stutzeri RCH2)
MDLSDPKDLASLLEAFLLASGKPLSLERLGELFEENERPSSAQLKKALEVLEKSCKGRAF
ELKEVASGYRLQVRQRFSPWVGRLWEERPQRYSRAMLETLALIAYRQPITRGEIEDIRGV
AVNSQIVKTLLEREWVRVVGHRDVPGRPAMFATTRQFLDHFNLKNLDELPPLAVLREMEP
ELQPILDDEDAPVPVALQARADEVVDEEAAPLREQTSFRSLLAELDGMEQGLKTDFDDLL
EAQAADIDPDEEQSSP