Protein Info for Psest_0186 in Pseudomonas stutzeri RCH2

Annotation: Protein-disulfide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01323: DSBA" amino acids 96 to 183 (88 residues), 49.9 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 73% identical to DSBA_PSEAE: Thiol:disulfide interchange protein DsbA (dsbA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 93% identity to psa:PST_4059)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGA8 at UniProt or InterPro

Protein Sequence (209 amino acids)

>Psest_0186 Protein-disulfide isomerase (Pseudomonas stutzeri RCH2)
MRNFLLTAIFAAASLFGAAAQAAEFQAGKEYVELSSPVPVADPSKIEVVELFWYGCPHCY
QFEPVIKPWVEQLPEDVQFKRIPAMFGGIWNVHGQLFIALESMGVEPKVHDAVFAAYHQE
RKKLATPDEMADFLAGHGIDKQAFLKAYNSFGVRGRVEQAKKLGMAYQITGVPVMIVNGK
YRFDLGSSGGPERTLQVADFLIEKERAAR