Protein Info for PGA1_c18750 in Phaeobacter inhibens DSM 17395

Annotation: protein DddP (metallopeptidase, family M24), DMSP degrading

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 PF01321: Creatinase_N" amino acids 74 to 221 (148 residues), 27.5 bits, see alignment E=4e-10 PF00557: Peptidase_M24" amino acids 230 to 443 (214 residues), 86.9 bits, see alignment E=1.7e-28

Best Hits

Swiss-Prot: 82% identical to DDDP_ROSNI: Dimethlysulfonioproprionate lyase DddP (dddP) from Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM)

KEGG orthology group: None (inferred from 80% identity to sit:TM1040_1016)

MetaCyc: 82% identical to DMSP lyase monomer (Roseovarius nubinhibens ISM)
Dimethylpropiothetin dethiomethylase. [EC: 4.4.1.3]

Predicted SEED Role

"Proline dipeptidase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DR70 at UniProt or InterPro

Protein Sequence (463 amino acids)

>PGA1_c18750 protein DddP (metallopeptidase, family M24), DMSP degrading (Phaeobacter inhibens DSM 17395)
MSSDTFETMSNTEPEMNEHYRDTRKIDPTRGATLGDNTPNDQDRVEIGPTQLAFGEWAAA
GLQLPDLQAMRRYRWERLTRFINDRDYAGLLVFDPMNIRYATDSTNMQLWNTHNPFRALL
ICADGYMVMWDYKQAPFLSEFNPLVREQRAGADLFYFDRGDKVDVAADAFANEVRTLLAE
HSGGNTRLAVDKIMLHGLRALEAQGLEVFPGEELTEKCRAVKGPDEILAMRCANHACETT
VAEMERYARSAIPGGQISEDDVWAVLHAENIRRGGEWIETRLLTSGPRTNPWFQECGGRI
IQNNEIISFDTDLVGSYGICIDISRSWWIGDRAPPADMVYAMQHGVEHIQSNMEMLKPGV
NLQELSRNCHLLDAQFQKQKYGCMMHGVGLCDEWPLVAYPDAMVEGAFDYDLEPGMVLCV
EALVSPEGGDFSIKLEDQVLITETGYENLTTYPFDPALMGTTR