Protein Info for HP15_1805 in Marinobacter adhaerens HP15

Annotation: hydroxyacylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 4 to 264 (261 residues), 322.4 bits, see alignment E=8.9e-101 PF00753: Lactamase_B" amino acids 23 to 173 (151 residues), 70.8 bits, see alignment E=1.5e-23 PF16123: HAGH_C" amino acids 174 to 264 (91 residues), 82.5 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 67% identical to GLO2_MARHV: Hydroxyacylglutathione hydrolase (gloB) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 67% identity to maq:Maqu_1536)

MetaCyc: 49% identical to hydroxyacylglutathione hydrolase GloB (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNS5 at UniProt or InterPro

Protein Sequence (264 amino acids)

>HP15_1805 hydroxyacylglutathione hydrolase (Marinobacter adhaerens HP15)
MLTISAIPAFSDNYIWCLSDTASDKALIVDPGQAQPVLDHLAENGLTLDTILVTHHHPDH
VGGVKDLISRFPDCRVTGPADSPYKGSTNLVHPGDEVIWEDITFQVLGVPGHTLDHIAYF
TDVEVNGRPVLFCGDTLFVCGCGRLFEGSPEQMRQSLQTLRALPGKTAVYCAHEYTLANL
RFARSWLPEDEGLRTFEQECQAARDAGKPTVPSVLENEKRLNPFLRWDDPAVVDSARAYC
SSRGLPADSDNAIFAAIRHGKDNF