Protein Info for PGA1_c18700 in Phaeobacter inhibens DSM 17395

Annotation: yjeF C-terminal region, hydroxyethylthiazole kinase-related/yjeF N-terminal region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 565 TIGR00197: YjeF family N-terminal domain" amino acids 6 to 180 (175 residues), 101.8 bits, see alignment E=4e-33 PF03853: YjeF_N" amino acids 27 to 181 (155 residues), 122.2 bits, see alignment E=2.3e-39 TIGR00196: YjeF family C-terminal domain" amino acids 289 to 560 (272 residues), 173.2 bits, see alignment E=7.2e-55 PF01256: Carb_kinase" amino acids 304 to 542 (239 residues), 169 bits, see alignment E=1.3e-53

Best Hits

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DR67 at UniProt or InterPro

Protein Sequence (565 amino acids)

>PGA1_c18700 yjeF C-terminal region, hydroxyethylthiazole kinase-related/yjeF N-terminal region (Phaeobacter inhibens DSM 17395)
MTELLTAAQMRAIEQAAIASGEVTGLELMERAGQGVVEAIFEEWPEYESAPQSVAVLCGP
GNNGGDGFVVARLLAGKGWTVKVFLYGDPDKLPADARTNYEIWLADNQVEELTERAFRKE
PYSLHIDALFGTGLSRPLEGEAFNVASHMSGRNGDDYSDSVVAIDAPSGLCLDSGTVLEE
APPSLGHPIFDQQGQEPRGRKPFQDRFAALTVTFDSPKFGHFVNEGPSVCGQVVVKDIGL
EQWRVLKGTKPGTPPRSLRLPHSVLLGERPLVKDRRKPWISRFGFVRCKKASTKGHKYTH
GHALVLSGGHGKTGAARLAARGALRIGAGLVTVGAPRAAMMENACQLTAIMLRQMDGADE
LRTLLQDSRFNVVCLGPGLGLAADREGLVLEVLQANRATVLDADALTQFEDRAEALFEVL
HENCVLTPHGGEFARLFPDLAEKLNAPATTGPAYSKVDATREAAKRAGCVVLFKGPDTVI
ASPNGCCSVNSAHYQRSAPWLATAGSGDVLAGFITGLMARGLSPMQAAETAAYLHVECAL
NFGPGLIAEDLPEQIPTVLRRLDIP