Protein Info for PGA1_c01880 in Phaeobacter inhibens DSM 17395

Annotation: 30S ribosomal protein S13

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 PF00416: Ribosomal_S13" amino acids 3 to 109 (107 residues), 109 bits, see alignment E=1.2e-35 TIGR03631: ribosomal protein uS13" amino acids 3 to 115 (113 residues), 180.3 bits, see alignment E=6.8e-58

Best Hits

Swiss-Prot: 96% identical to RS13_RUEPO: 30S ribosomal protein S13 (rpsM) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K02952, small subunit ribosomal protein S13 (inferred from 95% identity to sit:TM1040_0277)

MetaCyc: 62% identical to 30S ribosomal subunit protein S13 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S13p (S18e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLB9 at UniProt or InterPro

Protein Sequence (122 amino acids)

>PGA1_c01880 30S ribosomal protein S13 (Phaeobacter inhibens DSM 17395)
MARIAGVNIPTAKRVPIALTYITGIGTTSAEAICEAVGIDATRRVNELSDAEVLAVREHI
DANYTVEGDLRREVQMNIKRLMDLGCYRGLRHRRNLPVRGQRTHTNARTRKGPAKAIAGK
KK