Protein Info for Psest_1869 in Pseudomonas stutzeri RCH2

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 6 to 595 (590 residues), 808.6 bits, see alignment E=3.1e-247 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 8 to 455 (448 residues), 501.5 bits, see alignment E=2.5e-154 PF00270: DEAD" amino acids 21 to 183 (163 residues), 84 bits, see alignment E=2.7e-27 PF00271: Helicase_C" amino acids 218 to 323 (106 residues), 65.6 bits, see alignment E=1.2e-21 PF16124: RecQ_Zn_bind" amino acids 335 to 396 (62 residues), 73.8 bits, see alignment 3.8e-24 PF09382: RQC" amino acids 401 to 509 (109 residues), 119.6 bits, see alignment E=1.6e-38 PF00570: HRDC" amino acids 529 to 594 (66 residues), 76 bits, see alignment E=4.6e-25

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 96% identity to psa:PST_2467)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM02 at UniProt or InterPro

Protein Sequence (707 amino acids)

>Psest_1869 ATP-dependent DNA helicase RecQ (Pseudomonas stutzeri RCH2)
MLDQAQRILKDVFGYDAFRGNQGAIIERVGSGGDALVLMPTGGGKSLCYQVPALLRDGLA
VVVSPLIALMDDQVATLDELGVSAVALNSTLSPDEQRDIAERIRRNEIKMLYLAPERLVQ
PRMLAFLQRLEIALFAIDEAHCVSQWGHDFRPEYMQLGQLSELFPGVPRIALTATADMRT
REEIVQRLHLENAERFLSSFDRPNIFYRIVPKEQPRKQLLGFLAERRGDAGIVYCMSRKK
VDDFAAFLTEQGFPALPYHAGLPNELRAYHQKRFLNEEGLIMVATIAFGMGIDKPNVRFV
AHLDLPKSLEAYYQETGRAGRDGLPADAWMAYGLQDVIFLKQMLNNSEGDERHKRVEQHK
LDAMLALCEETRCRRQALLAYFDEELPSPCGHCDNCVDGVQTWDATEPARQALSAIYRSG
QRYGVGHLVDVLLGRDNDKVRGLGHQHLSVFGVGKALAETEWRSLFRQLVARGLADVDLD
GFGGLRLSDSCRPLLRGEVSLELRRDLSSKAPKPAASAASQLVRSEERETWEALRTLRRK
LAEEHSVPPYVIFPDATLLEMLRSQPASLSDMAMISGVGARKLERYGQAFLEVLQGNSDV
AKPPADLRHELITLARAGMTPAQIARQLDCSEKNVYAMLAEAIGLQQLSLEQALDLPEDL
LGEIQEAFLDGEGELPPVSAVAEQFAGRVPEQVLYCVRAALQVEFEL