Protein Info for PGA1_c01870 in Phaeobacter inhibens DSM 17395

Annotation: adenylate kinase Adk

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 TIGR01351: adenylate kinase" amino acids 3 to 209 (207 residues), 227.2 bits, see alignment E=8.8e-72 PF13671: AAA_33" amino acids 4 to 129 (126 residues), 34 bits, see alignment E=6.9e-12 PF00406: ADK" amino acids 6 to 191 (186 residues), 178.9 bits, see alignment E=1.4e-56 PF13207: AAA_17" amino acids 7 to 129 (123 residues), 85.6 bits, see alignment E=7.8e-28 PF05191: ADK_lid" amino acids 127 to 163 (37 residues), 29.1 bits, see alignment 1.4e-10

Best Hits

Swiss-Prot: 72% identical to KAD_PARDP: Adenylate kinase (adk) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K00939, adenylate kinase [EC: 2.7.4.3] (inferred from 72% identity to pde:Pden_0781)

Predicted SEED Role

"Adenylate kinase (EC 2.7.4.3)" in subsystem Purine conversions (EC 2.7.4.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.3

Use Curated BLAST to search for 2.7.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EVV4 at UniProt or InterPro

Protein Sequence (215 amino acids)

>PGA1_c01870 adenylate kinase Adk (Phaeobacter inhibens DSM 17395)
MSNIILLGPPGAGKGTQARYLVESRNMVQLSTGDMLRDAQASGSEMGKRVADVIARGELV
TDRIVIGLIREKIEEGAEGGFIFDGFPRTLAQADALAELLRETGQKLDAVIEMQVDDTAL
VARITGRSTCGDCGEVYHDETKPWPEDGKCANCGGTNQKRRPDDNEESLRTRLMEYYKKT
SPLIGYYYAKGNLQRLDGLASIEEVRKNLGWIMGD