Protein Info for HP15_1785 in Marinobacter adhaerens HP15

Annotation: DsrE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02635: DsrE
  • amino acids 5 to 128 (124 residues), 60.2 bits, E=1.1e-20
• TIGR03012: sulfur relay protein TusD/DsrE
  • amino acids 5 to 130 (126 residues), 128.6 bits, E=6.2e-42

Best Hits

Swiss-Prot: 40% identical to TUSD_SALEP: Sulfurtransferase TusD (tusD) from Salmonella enteritidis PT4 (strain P125109)

KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 75% identity to maq:Maqu_1519)

MetaCyc: 39% identical to sulfurtransferase complex subunit TusD (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"

MetaCyc Pathways

• tRNA-uridine 2-thiolation and selenation (bacteria) (5/11 steps found)

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

See E4PNQ5 at UniProt or InterPro

Protein Sequence (134 amino acids)

>HP15_1785 DsrE family protein (Marinobacter adhaerens HP15)
MSETFTLVITGAPYSSQAPQTALGFAKAAVDAGHHIDRVFLYGDGVHLASALCAPPSDET
HWPDEWSRFLTQHNIPGVACIASALRRGLVNETEQKRYELPSANLRAPFEIAGLGEWVEG
RIKSTRTLYFHAGD