Protein Info for Psest_1866 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 44 to 45 (2 residues), see Phobius details amino acids 88 to 125 (38 residues), see Phobius details PF04304: DUF454" amino acids 16 to 129 (114 residues), 142.7 bits, see alignment E=2.5e-46

Best Hits

Swiss-Prot: 43% identical to YBAN_SHIFL: Inner membrane protein YbaN (ybaN) from Shigella flexneri

KEGG orthology group: K09790, hypothetical protein (inferred from 84% identity to psa:PST_2469)

Predicted SEED Role

"FIG039061: hypothetical protein related to heme utilization"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKU4 at UniProt or InterPro

Protein Sequence (139 amino acids)

>Psest_1866 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MAHRDIQQHRNPLVRSALLTAGWLAVALGVIGIFLPVLPTTPFLLLAAACFVRSSQRFYR
WLVDHPHLGPWFRDYLEGNGIPLKGKAYAIATMWVSIGISCWLVPLFWARIGMLLSASLV
SLYILRQKTLPVAKLDQRR