Protein Info for PGA1_c18430 in Phaeobacter inhibens DSM 17395

Annotation: phage terminase large subunit (GpA)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 PF05876: GpA_ATPase" amino acids 47 to 295 (249 residues), 265.7 bits, see alignment E=4.5e-83 PF20454: GpA_nuclease" amino acids 310 to 589 (280 residues), 337.1 bits, see alignment E=8.6e-105

Best Hits

KEGG orthology group: None (inferred from 89% identity to sit:TM1040_1302)

Predicted SEED Role

"Phage terminase, large subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZX4 at UniProt or InterPro

Protein Sequence (649 amino acids)

>PGA1_c18430 phage terminase large subunit (GpA) (Phaeobacter inhibens DSM 17395)
MNARADFSNSRALVNCTRRAQAFLRPPPDLKPSEWAEQNIKIPIGNAVPGPMRFDNAPYQ
REVIDMTANPRCNRISLMWGAQVGKTQTALAAQAFRIGFNPVSQMMMQPSQGDLTTWLET
KFNPLIEGNEDLAEVIAKPRARHGVNNQRMKSYPGGFLMFSWSGSPKTMRGRSAPFIICD
ETDGYDRTSEGHPVSLLWQRAATFGDQRLLLEISTPTIKGGSWIEKAFEQGDQRYFYVRC
PHCGHLQKLQWSQVDWNKDAEGVNLPETAGYLCAGDGCGTVWNDGERVAAIRNAEREGGG
WIGTKAFRGHASFHLSELYSCFRRLEDIVQSFLDKRAAGDLQTFVNVSLAETWEEEGDKL
EASALMARAKEFTAPVPMGAGVLTAGIDMQNDRLEVEIVAWGLGEESWSVDYRVLWGDPL
QQDVWDELDALLAETWGHESGTDLRISAACMDTGGEGGRTQAAYDYARKRLGRKVWAIKG
VGGWGRPIVTQPSKVKQRGVRPVYLHSIGVDEAKVVVAQRARITEPGPGHCHFPTGRDPA
WFDMFTAEALRTRYVKGFAVREWHNVRPRNEAFDCRVYAYAALSILRPNIKRLVTALEVQ
GGEDQDLDQAPQGDAPENMPEDTSPANSDSGPKRRRTNRRKRRRRHNLE