Protein Info for PGA1_c18400 in Phaeobacter inhibens DSM 17395

Annotation: peptidase U35, phage prohead HK97-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 PF04586: Peptidase_S78" amino acids 52 to 179 (128 residues), 28.1 bits, see alignment E=2.2e-10 TIGR01554: phage major capsid protein, HK97 family" amino acids 340 to 671 (332 residues), 95.3 bits, see alignment E=2.2e-31 PF05065: Phage_capsid" amino acids 402 to 673 (272 residues), 156.9 bits, see alignment E=7.5e-50

Best Hits

KEGG orthology group: None (inferred from 77% identity to sit:TM1040_1299)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXH2 at UniProt or InterPro

Protein Sequence (676 amino acids)

>PGA1_c18400 peptidase U35, phage prohead HK97-like protein (Phaeobacter inhibens DSM 17395)
MRKPSDLIGKSLTRSLTPEQINAGQRGGGQGLQRVAEVVTIDEEARTVELAFSSTTPVMR
WFGEEVLSHGPGAVDLERLNNGGALLMDHNWRDQVGVIVSSRIDADQVGRAVVRFSRSAR
ADEIFQDVVDGIRSHVSVGYSVSEIKEEKRDGQANLVTVTRWVPFEVSMVAVPADQTVGV
GRSGENLPEVTGDDTGQIAENETGAGNEAAGNQQREFEMKTIITRDNEGNLVRAKVDDNG
NIVEVVEMLERAGAGDAALLQRGREQEATRVRELTEIGSQYDAEDLALELIRSGQGVEDM
NARLLDHLHQRSTNHRQIMDRSDIGMTDDEADQFSFLRAIRALANPTDRAAQEAAAFEFE
ASDAAAEAQGRDAQGVMVPMNVLMRAPLNTGTGGVGAGDTGGNAIANPLLSQSFIQMLRV
RAILLRLATPLMGLVGNPDIPTQEGGATGYWIGEDGEAAEDILSLGQRQFSPKTVAAYSE
ITRRTLKQTSMDIEALVRSDLALALATSLDLAGFYGTGTDDQPLGIANTNGVNVVDFGGA
GSGGGAAMPTWEDVIQMESEIAAANADVDRMAYVQNAKMRGHFKSKQKFAGTNGAPIWES
DNTVNGYRGEVTNQIKQGDVFHGDFGNVLVGMWGGLDLTVDPYTHSRRGRLRLVAMQDAD
FVLRHAAGLCYGTDAS