Protein Info for Psest_0182 in Pseudomonas stutzeri RCH2

Annotation: glycine cleavage system H protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 127 (125 residues), 160.8 bits, E=8.4e-52
• PF01597: GCV_H
  • amino acids 8 to 125 (118 residues), 146.4 bits, E=1.9e-47

Best Hits

Swiss-Prot: 80% identical to GCSH2_PSEAE: Glycine cleavage system H protein 2 (gcvH2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 95% identity to psa:PST_4063)

MetaCyc: 64% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See L0GDG9 at UniProt or InterPro

Protein Sequence (129 amino acids)

>Psest_0182 glycine cleavage system H protein (Pseudomonas stutzeri RCH2)
MSNIPSDLRYAASHEWARLEADGSITVGISDHAQEALGDVVYVELPEVGRQLNAGQEAGV
VESVKAASDIYAPVSGEVVAINEALADSPELVNSDAYGSWFFRLQPSDPAELDKLLDAAA
YQAACDADA