Protein Info for HP15_1766 in Marinobacter adhaerens HP15

Annotation: FAD dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF00070: Pyr_redox" amino acids 13 to 47 (35 residues), 24.2 bits, see alignment 1e-08 PF00890: FAD_binding_2" amino acids 14 to 51 (38 residues), 23.2 bits, see alignment 9.6e-09 PF13450: NAD_binding_8" amino acids 16 to 80 (65 residues), 55.7 bits, see alignment E=1.2e-18 PF01593: Amino_oxidase" amino acids 21 to 81 (61 residues), 50.6 bits, see alignment E=4.8e-17 amino acids 119 to 329 (211 residues), 40.4 bits, see alignment E=6.3e-14

Best Hits

KEGG orthology group: K06955, (no description) (inferred from 58% identity to maq:Maqu_1481)

Predicted SEED Role

"COG3380: Amine oxidase, flavin-containing"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNN6 at UniProt or InterPro

Protein Sequence (342 amino acids)

>HP15_1766 FAD dependent oxidoreductase (Marinobacter adhaerens HP15)
MFNQTFDSSLIRRIAIVGSGLSGLTAAIQLRGFGHDVTVFEKSRGPGGRLAAKRVTGGSA
DMGAQYFTSRNPDFLPFLHKFAGPESFGPWEGRFGFQTNADKWESFPQETRYVGIPRMTA
ITRALSGHAHVVTETRVARLARNDQSWSLFSTAGSHLGDFDAVIVTAPPAQARDLLADSS
LDALASYLDDPVSRVLPCWAVAAHFPVSPWPHHEGMRCKHPALFWVANNSSKPGRDDEGQ
WWVFHASPAWTEDHVDTPAEEVAEKLLAAFRETTGFDTGPDEVVTHRWLYARSEGGEHPG
HLWFPDYKIGLAGDWLSGGRVEGAFDSACGLVAELTTAPTTQ