Protein Info for PGA1_c18330 in Phaeobacter inhibens DSM 17395

Annotation: baseplate assembly protein J

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 PF26776: Baseplate_J_N" amino acids 47 to 104 (58 residues), 88.2 bits, see alignment E=5.4e-29 PF26078: Baseplate_J_M" amino acids 133 to 205 (73 residues), 52.8 bits, see alignment E=6.3e-18 PF26079: Baseplate_J_C" amino acids 212 to 293 (82 residues), 34.7 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 49% identical to BPJ_BPP2: Baseplate protein J (J) from Escherichia phage P2

KEGG orthology group: None (inferred from 86% identity to sit:TM1040_1291)

Predicted SEED Role

"Baseplate assembly protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZW4 at UniProt or InterPro

Protein Sequence (299 amino acids)

>PGA1_c18330 baseplate assembly protein J (Phaeobacter inhibens DSM 17395)
MADGFTSINLSQLPAPEVLQAVDFETALADMLAELRQRDPVFDALVESDPAYKILEIAAF
YRALAIQQVNDAARAVMPAYATGADLDHIAARYAVERLLIEPGDPQALPPVAPVLESDAA
LRRRMFLAFEGLSTAGPMGAYVFHALGADPDVGDASVESPAPGEVLVTILSRSGNGAAPA
ALLAAVDTALNADDVRPLTDLVTVRGAEVLTYTIEAVLTVLPGPDSAVVREAAESAALAY
ASQQRRIGADITLSGLYAALHQPGVQNVALVSPVADIAVGASQAAFCIAVSVSIGGANV