Protein Info for HP15_1763 in Marinobacter adhaerens HP15

Annotation: anti-anti-sigma regulatory factor (antagonist of anti-sigma factor)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF01740: STAS" amino acids 10 to 104 (95 residues), 36.6 bits, see alignment E=3.3e-13 PF13466: STAS_2" amino acids 16 to 101 (86 residues), 30.2 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to maq:Maqu_1478)

Predicted SEED Role

"Serine-protein kinase RsbW (EC 2.7.11.1)" (EC 2.7.11.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.11.1

Use Curated BLAST to search for 2.7.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNN3 at UniProt or InterPro

Protein Sequence (163 amino acids)

>HP15_1763 anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) (Marinobacter adhaerens HP15)
MAGYKILQAEKQGIYVLKFIGEIRLNLCSTLDNLVESITQDPEFKTVVIDLTETEIIDST
TLGLLAKIAMAAQKQSNFLPTLISTNPDITRIITSMGFDKIFIIVREPASRIEELEEIPV
LRASEQQVRDKVLDAHKVLMGLNSRNREEFKNLVRALECEEPG