Protein Info for Psest_0018 in Pseudomonas stutzeri RCH2

Annotation: ectoine/hydroxyectoine ABC transporter, permease protein EhuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details TIGR03004: ectoine/hydroxyectoine ABC transporter, permease protein EhuC" amino acids 3 to 215 (213 residues), 316.3 bits, see alignment E=1.1e-98 TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 5 to 104 (100 residues), 89.7 bits, see alignment E=1.5e-29 PF00528: BPD_transp_1" amino acids 27 to 210 (184 residues), 61.8 bits, see alignment E=3.7e-21

Best Hits

Swiss-Prot: 41% identical to YECS_ECOLI: L-cystine transport system permease protein YecS (yecS) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 94% identity to psa:PST_0016)

MetaCyc: 41% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GF43 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Psest_0018 ectoine/hydroxyectoine ABC transporter, permease protein EhuC (Pseudomonas stutzeri RCH2)
MIELLPLLLQGAWVTVKVTFFGSLLAIACALIAALARLSPVAPLRWLAITYIEVFRGSSL
LVQLFWLYFVLPMPPFNIEMSAFAVAVVGLGLNIGAYGAEVLRGAIRSVHRGQHEACQAL
NMTPLTRMRRIILPQALLAAIPPGTNLLIELLKNTSLVSLITLSDLAFRARQLDQATLMT
MEIFGLALVIYFVLAQTINFGMRQLERRLARGRMRGGLS