Protein Info for HP15_1745 in Marinobacter adhaerens HP15

Annotation: methyltransferase type 11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF13489: Methyltransf_23" amino acids 32 to 186 (155 residues), 58.1 bits, see alignment E=2.9e-19 PF13847: Methyltransf_31" amino acids 39 to 148 (110 residues), 36.6 bits, see alignment E=1.2e-12 PF13649: Methyltransf_25" amino acids 41 to 134 (94 residues), 59.4 bits, see alignment E=1.4e-19 PF08241: Methyltransf_11" amino acids 42 to 138 (97 residues), 70.6 bits, see alignment E=4.4e-23 PF08242: Methyltransf_12" amino acids 42 to 136 (95 residues), 42.7 bits, see alignment E=2.4e-14 PF01209: Ubie_methyltran" amino acids 58 to 142 (85 residues), 47.7 bits, see alignment E=3.9e-16

Best Hits

KEGG orthology group: K00551, phosphatidylethanolamine N-methyltransferase [EC: 2.1.1.17] (inferred from 86% identity to maq:Maqu_1462)

Predicted SEED Role

"SAM-dependent methyltransferase PA0798 (UbiE paralog)"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PNL5 at UniProt or InterPro

Protein Sequence (217 amino acids)

>HP15_1745 methyltransferase type 11 (Marinobacter adhaerens HP15)
MVMPMSFYEDRILPHIIDRACSMGQVMKLRSQVVPHAKGVVLEVGMGSAINMEFYNANNV
DMVYGLEPSEGMRRKAQPNLAKTPIKVEWLDLPGEKIPLDDNSVDTVLLTFTLCTIPDWN
AALQQMRRVLKPGGELLFLEHGESPHDDTRKWQNRITPGWKKLAGGCHLNRHIADLIRHA
GFEIQELENLYIPKAPKIAGYIYKGRAINPVETSPAA